« Zurück
Home /
Recombinant Human IL-1b/IL-1 beta/IL-1F2 Protein

Recombinant Human IL-1b/IL-1 beta/IL-1F2 Protein

ArtNr	RP00620-50ug
Hersteller	Abclonal
Menge	50 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Human
Purity	> 95% by SDS-PAGE.
Sequence	APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
NCBI	IL-1b/IL-1 beta/IL-1F2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	IL-1,IL1-BETA,IL1F2,IL1 beta,IL1B
Lieferbar
Description	Reconstitute to a concentration of 0.1-0.5 mg/mL in 1X PBS.
Background	IL1B belongs to the IL-1 family. Interleukin 1 (IL-1) is a family of polypeptide cytokines consisting of twoagonists, IL-1 alpha (IL-1F1) and IL-1 beta (IL-1F2) encoded by two distinct genes and perform identicalbiological functions. IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation andproliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response. It isidentified as endogenous pyrogens, and is reported to stimulate the release of prostaglandin and collagenasefrom synovial cells.
Route	No tag
Manufacturers Category	Proteins
Endotoxin	< 1 EU/μg of the protein by LAL method.
Immunogen	Ala117-Ser269
Storage	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area	Cytokines & Cytokine Receptors
Gene Symbol	IL-1b/IL-1 beta/IL-1F2
Protein Formulation	Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH7.4Contact us for customized product form or formulation.
Protein Description	Recombinant Human IL-1b/IL-1 beta/IL-1F2 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala117-Ser269) of human IL-1b/IL-1 beta/IL-1F2 (Accession #P01584) fused with an initial Met at the N-terminus.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 27.09.2024

Express-Lieferung: 30 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail