ArtNr |
RP00598-50ug |
Hersteller |
Abclonal
|
Menge |
50 ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
Mouse |
Purity |
> 95% by SDS-PAGE. |
Sequence |
EQAPGTSPCSSGSSWSADLDKCMDCASCPARPHSDFCLGCAAAPPAHFRLLW |
NCBI |
TNFRSF12A/TWEAK R/CD266 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Tumor necrosis factor receptor superfamily member 12A;Fibroblast growth factor-inducibleimmediate-early response protein 14;Fibroblast growth factor-regulated protein 2;Tweak-receptor;TweakR;TNFRSF12 |
Lieferbar |
|
Description |
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. |
Background |
Tumor necrosis factor receptor superfamily member 12A(Tnfrsf12a) is a single-pass type I membrane protein and contains1 TNFR-Cys repeat. It is weak inducer of apoptosis in some cell types.It promotes angiogenesis and it is the proliferation ofendothelial cells. It may modulate cellular adhesion to matrix proteins.TNFR binds specifically to tumor necrosis factor(TNF) and blocks its interaction with cell surface TNF receptors. TNF is a naturally occurring cytokine that is involved innormal inflammatory and immune responses. It plays an important role in the inflammatory processes of rheumatoidarthritis (RA), polyarticular-course juvenile rheumatoid arthritis (JRA), and ankylosing spondylitis and the resulting jointpathology. In addition, TNF plays a role in the inflammatory process of plaque psoriasis. Elevated levels of TNF are found ininvolved tissues and fluids of patients with RA, psoriatic arthritis, ankylosing spondylitis (AS), and plaque psoriasis. Twodistinct receptors for TNF (TNFRs), a 55 kilodalton protein (p55) and a 75 kilodalton protein (p75), exist naturally asmonomeric molecules on cell surfaces and in soluble forms. Biological activity of TNF is dependent upon binding to eithercell surface TNFR. |
Route |
C-Fc |
Manufacturers Category |
Proteins |
Endotoxin |
< 1 EU/μg of the protein by LAL method. |
Immunogen |
Glu28-Trp79 |
Storage |
Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week. |
Manufacturers Research Area |
Bio-Markers & CD Antigens |
Gene Symbol |
TNFRSF12A/TWEAK R/CD266 |
Protein Formulation |
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation. |
Protein Description |
Recombinant Mouse TNFRSF12A/TWEAK R/CD266 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Glu28-Trp79) of mouse TNFRSF12A/TWEAK R/CD266 (Accession #Q9CR75) fused with an Fc tag at the C-terminus. |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.