« Zurück
Home /
Recombinant Human IFNA1/IFNA13/IFN-alphaD/IFN-alpha 1/13 Protein

Recombinant Human IFNA1/IFNA13/IFN-alphaD/IFN-alpha 1/13 Protein

ArtNr	RP00587-10ug
Hersteller	Abclonal
Menge	10 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Human
Purity	> 95% by SDS-PAGE.
Sequence	CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE
NCBI	IFNA1/IFNA13/IFN-alphaD/IFN-alpha 1/13
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Interferon alpha-1/13;IFN-alpha-1/13; Interferon alpha-D;LeIF D;IFNA1;IFNA13
Lieferbar
Description	Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Background	Interferon alpha-1/13(IFN-alpha-1/13 for short), also known as Interferon alpha-D, is a secreted protein whichbelongs to the alpha/beta interferon family. It is produced by macrophages. IFN-alpha have antiviral activities.Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. IFN-alpha exerts a variety of other biological effects, including antitumor and immunomodulatory activities and areincreasingly used clinically to treat a range of malignancies, myelodysplasias and autoimmune diseases.
Route	C-6×His
Manufacturers Category	Proteins
Endotoxin	< 1 EU/μg of the protein by LAL method.
Immunogen	Cys24-Glu189
Storage	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area	Cytokines & Cytokine Receptors
Gene Symbol	IFNA1/IFNA13/IFN-alphaD/IFN-alpha 1/13
Protein Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH7.4.Contact us for customized product form or formulation.
Protein Description	Recombinant Human IFNA1/IFNA13/IFN-alphaD/IFN-alpha 1/13 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Cys24-Glu189) of human IFNA1/IFNA13/IFN-alphaD/IFN-alpha 1/13 (Accession #P01562) fused with a 6×His tag at the C-terminus.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 27.09.2024

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail