« Zurück
Home /
DCBLD2 Recombinant Protein

DCBLD2 Recombinant Protein

ArtNr	PRS-92-462-0.05mg
Hersteller	ProSci
Menge	0.05 mg
Kategorie	Oncology Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins By Organ Skin Cancer Testicular & Prostate Cancer
Typ	Proteins Recombinant
Format	Lyophilized
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Discoidin, CUB and LCCL domain-containing protein 2, DCBLD2, CUB, LCCL and coagulation factor V/VIII-homology domains protein 1, Endothelial and smooth muscle cell-derived neuropilin-like protein, CLCP1, ESDN
Lieferbar
Applications	This recombinant protein can be used for biological assays. For research use only.
Applications	This recombinant protein can be used for biological assays. For research use only.
Buffer	Lyophilized from a 0.2 um filtered solution of PBS, pH7.4. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O.
Storage Conditions	Lyophilized protein should be stored at -20˚ C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7˚ C for 2-7 days. Aliquots of reconstituted samples are stable at -20˚ C for 3 months.
Disclaimer	Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.
Predicted Molecular Weight	52.2 kD
Purity	Greater than 95% as determined by reducing SDS-PAGE. Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Background	Discoidin, CUB and LCCL domain-containing protein 2(DCBLD2) is a protein contains 1 CUB domain, 1 F5/8 type C domain, 1 LCCL domain. DCBLD2 is Highly expressed in testis, heart, skeletal muscle and also in cultured vascular smooth muscle cells. Model organisms have been used in the study of DCBLD2 function. Male and female animals underwent a standardized phenotypic screen to determine the effects of deletion. Additional screens performed: In-depth immunological phenotyping.
Accession #	Q96PD2
Ncbi Gene Id #	131566
Ncbi Official Symbol	DCBLD2
Ncbi Official Full Name	discoidin, CUB and LCCL domain containing 2
Ncbi Organism	Homo sapiens
Swissprot #	Q96PD2
Fusion Tag	C-6 His tag
Sequence	Gln67-Ala528
Protein Gi#	530363504
Peptide Sequence	QQGDGCGHTVLGPESGTLTSINYPQTYPNSTVCEWEIRVKMGERVRIKFGDFDIEDSDSCHFNYLRIYNGIGVSRTEIGKYCGLGLQMNHSIESKGNEITLLFMSGIHVSGRGFLASYSVIDKQDLITCLDTASNFLEPEFSKYCPAGCLLPFAEISGTIPHGYRDSSPLCMAGVHAGVVSNTLGGQISVVISKGIPYYESSLANNVTSVVGHLSTSLFTFKTSGCYGTLGMESGVIADPQITASSVLEWTDHTGQENSWKPKKARLKKPGPPWAAFATDEYQWLQIDLNKEKKITGIITTGSTMVEHNYYVSAYRILYSDDGQKWTVYREPGVEQDKIFQGNKDYHQDVRNNFLPPIIARFIRVNPTQWQQKIAMKMELLGCQFIPKGRPPKLTQPPPPRNSNDLKNTTAPPKIAKGRAPKFTQPLQPRSSNEFPAQTEQTTASPDIRNTTVTPNVTKDVAVDHHHHHH

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 0.05 mg

lieferbar

Lieferung vsl. bis 06.09.2024

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail