Vergleich

beta-NGF Recombinant Protein

ArtNr PRS-92-356-0.05mg
Hersteller ProSci
Menge 0.05 mg
Kategorie
Typ Proteins Recombinant
Format Lyophilized
Specific against other
Konjugat/Tag Tag Free
Purity Greater than 95% as determined by reducing SDS-PAGE.<br />Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Sequence SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVR
NCBI NGF
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Beta-Nerve Growth Factor, Beta-NGF, NGF, NGFB
Lieferbar
Manufacturer - Applications
This recombinant protein can be used for biological assays. For research use only.
Storage Conditions
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at -20°C for 3 months.
Molecular Weight
13.5 kD
Background
Human beta -Nerve Growth Factor ( beta -NGF) was initially isolated in the mouse submandibular gland. It is composed of three non-covalently linked subunits alpha, beta , and gamma ; it exhibits all the biological activities ascribed to NGF. It is structurally related to BDNF, NT-3 and NT-4 and belongs to the cysteine-knot family of growth factors that assume stable dimeric structures. beta -NGF is a neurotrophic factor that signals through its receptor beta -NGF, and plays a crucial role in the development and preservation of the sensory and sympathetic nervous systems. beta -NGF also acts as a growth and differentiation factor for B lymphocytes and enhances B-cell survival. These results suggest that beta -NGF is a pleiotropic cytokine, which in addition to its neurotropic activities may have an important role in the regulation of the immune system. Human beta -NGF shares 90% sequence similarity with mouse protein and shows cross-species reactivity.
Buffer
Lyophilized from a 0.2 um filtered solution of 20mM PB, 250mM NaCl, pH 7.0. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O.
NCBI Official Name
nerve growth factor
NCBI Organism
Homo sapiens
Disclaimer
Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 0.05 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen