ArtNr |
PRS-92-281-0.05mg |
Hersteller |
ProSci
|
Menge |
0.05 mg |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Lyophilized |
Specific against |
other |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Sonic Hedgehog Protein, SHH, HHG-1, SHH(Cys25Ile-Ile) |
Lieferbar |
|
Applications |
This recombinant protein can be used for biological assays. For research use only. |
Applications |
This recombinant protein can be used for biological assays. For research use only. |
Buffer |
Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, 1mM DTT, pH 7.4. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O. |
Storage Conditions |
Lyophilized protein should be stored at -20˚ C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7˚ C for 2-7 days. Aliquots of reconstituted samples are stable at -20˚ C for 3 months. |
Disclaimer |
Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures. |
Predicted Molecular Weight |
19.8 kD |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test. |
Background |
Mouse Sonic Hedgehog Homolog (SHH) belongs to a three-protein family called Hedgehog. The other two family members are Indian Hedgehog (IHH) and Desert Hedgehog (DHH). Hedgehog proteins are key signaling molecules in embryonic development. SHH is expressed in various embryonic tissues and plays critical roles in regulating the patterning of many systems, such as limbs and brain. SHH also plays an important role in adult, including the division of adult stem cells and the development of certain cancers and other diseases.Mouse Shh is synthesized as a 437 aa precursor that contains a 24 aa signal sequence and a 413 aa mature region. The mature region is autocatalytically processed into a nonglycosylated, 20 kDa, 174 aa Nterminal fragment (ShhN), and a catalyticprocessing, glycosylated, 34 kDa, 239 aa Cterminal fragment. The 20 kDa ShhN fragment is the core of the active hedgehog molecule. Mouse ShhN is 99%, 98%, and 100% aa identical to human, rat and gerbil ShhN, respectively. |
Accession # |
Q62226 |
Ncbi Gene Id # |
20423 |
Ncbi Official Symbol |
Shh |
Ncbi Official Full Name |
sonic hedgehog |
Ncbi Organism |
Mus musculus |
Swissprot # |
Q62226 |
Fusion Tag |
Tag Free |
Sequence |
Cys25-Gly198(Cys25Ile-Ile) |
Peptide Sequence |
MIIGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.