ArtNr |
PRS-91-683-0.05mg |
Hersteller |
ProSci
|
Menge |
0.05 mg |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Lyophilized |
Specific against |
other |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
cGMP-Dependent Protein Kinase 1, cGK 1, cGK1, cGMP-Dependent Protein Kinase I, cGKI, PRKG1, PRKG1B, PRKGR1A, PRKGR1B |
Lieferbar |
|
Applications |
This recombinant protein can be used for biological assays. For research use only. |
Applications |
This recombinant protein can be used for biological assays. For research use only. |
Buffer |
Lyophilized from a 0.2 um filtered solution of 20mM Tris, 150mM NaCl, pH8.0. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O. |
Storage Conditions |
Lyophilized protein should be stored at -20˚ C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7˚ C for 2-7 days. Aliquots of reconstituted samples are stable at -20˚ C for 3 months. |
Disclaimer |
Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures. |
Predicted Molecular Weight |
78.8 kD |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test. |
Background |
cGMP-Dependent Protein Kinase 1 (PRKG1) belongs to the protein kinase superfamily and AGC Ser/Thr protein kinase family. PRKG1 contains one AGC-kinase C-terminal domain, two cyclic nucleotide-binding domains, and one protein kinase domain. PRKG1 is mainly expressed in the lung and placenta. PRKG1 acts as a key mediator of the nitric oxide (NO)/cGMP signaling pathway. PRKG1 can phosphorylate many proteins that regulate platelet activation and adhesion, smooth muscle contraction, cardiac function, gene expression, feedback of the NO-signaling pathway, and other processes involved in several aspects of the CNS like axon guidance, hippocampal and cerebellar learning, circadian rhythm, and nociception. |
Accession # |
Q13976-2 |
Ncbi Gene Id # |
5592 |
Ncbi Official Symbol |
PRKG1 |
Ncbi Official Full Name |
protein kinase, cGMP-dependent, type I |
Ncbi Organism |
Homo sapiens |
Swissprot # |
Q13976-2 |
Fusion Tag |
C-6 His tag |
Sequence |
Gly2-Pro686 |
Peptide Sequence |
MGTLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQAQKQSASTLQGEPRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSGWDIDFVDHHHHHH |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.