Vergleich

HAI-2 Recombinant Protein

ArtNr PRS-91-552-0.05mg
Hersteller ProSci
Menge 0.05 mg
Kategorie
Typ Proteins Recombinant
Format Lyophilized
Specific against other
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Kunitz-Type Protease Inhibitor 2, Hepatocyte Growth Factor Activator Inhibitor Type 2, HAI-2, Placental Bikunin, SPINT2, HAI2, KOP
Lieferbar
Applications
This recombinant protein can be used for biological assays. For research use only.
Applications
This recombinant protein can be used for biological assays. For research use only.
Buffer
Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.4. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O.
Storage Conditions
Lyophilized protein should be stored at -20˚ C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7˚ C for 2-7 days.
Aliquots of reconstituted samples are stable at -20˚ C for 3 months.
Disclaimer
Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.
Predicted Molecular Weight
20.22 kD
Purity
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Background
Hepatocyte Growth Factor Activator Inhibitor Type 2 (HAI2) is a single-pass type I membrane protein and contains two BPTI/Kunitz inhibitor domains. The first Kunitz domain is mainly responsible for the inhibitory activity against hepatocyte growth factor activator (HGFA). HAI2 is expressed in placenta, kidney, pancreas, prostate, testis, thymus and trachea. HAI2 serves as a inhibitor of HGF activator. It also inhibits plasmin, plasma and tissue kallikrein and factor XIa. Defects in HAI2 are the cause of diarrhea type 3 (DIAR3), also known as congenital sodium diarrhea (CSD).
Accession #
O43291
Ncbi Gene Id #
10653
Ncbi Official Symbol
SPINT2
Ncbi Official Full Name
serine peptidase inhibitor, Kunitz type, 2
Ncbi Organism
Homo sapiens
Swissprot #
O43291
Fusion Tag
C-6 His tag
Sequence
Ala28-Lys197
Peptide Sequence
ADRERSIHDFCLVSKVVGRCRASMPRWWYNVTDGSCQLFVYGGCDGNSNNYLTKEECLKKCATVTENATGDLATSRNAADSSVPSAPRRQDSEDHSSDMFNYEEYCTANAVTGPCRASFPRWYFDVERNSCNNFIYGGCRGNKNSYRSEEACMLRCFRQQENPPLPLGSKVDHHHHHH

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 0.05 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen