ArtNr |
PRS-91-215-0.05mg |
Hersteller |
ProSci
|
Menge |
0.05 mg |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid |
Specific against |
other |
Dry ice |
Yes
|
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
L-Lactate Dehydrogenase A Chain, LDH-A, Cell Proliferation-Inducing Gene 19 Protein, LDH Muscle Subunit, LDH-M, Renal Carcinoma Antigen NY-REN-59, LDHA, PIG19 |
Lieferbar |
|
Applications |
This recombinant protein can be used for biological assays. For research use only. |
Applications |
This recombinant protein can be used for biological assays. For research use only. |
Buffer |
Supplied as a 0.2 um filtered solution of 20mM TrisHCl, 100mM NaCl, 50% Glycerol, pH 8.0. It is not recommended to reconstitute to a concentration less than 100 ug/ml. |
Storage Conditions |
Store at -20˚ C, stable for 6 months after receipt. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Disclaimer |
Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures. |
Predicted Molecular Weight |
38.8 kD |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test. |
Background |
L-Lactate Dehydrogenase A Chain (LDHA) is an enzyme that catalyzes the conversion of L-lactate and NAD+ to pyruvate and NADH in the final step of anaerobic glycolysis. LDHA contains an N-terminal coenzyme binding region, a central catalytic site, and at least nine utilized Lys acetylation and two Tyr phosphorylation sites. LDHA belongs to the lactate dehydrogenase family, expressed predominantly in muscle tissue. LDHA mutations have been linked to exertional myoglobinuria. |
Accession # |
P00338 |
Ncbi Gene Id # |
3939 |
Ncbi Official Symbol |
LDHA |
Ncbi Official Full Name |
lactate dehydrogenase A |
Ncbi Organism |
Homo sapiens |
Swissprot # |
P00338 |
Fusion Tag |
N-6 His tag |
Sequence |
Met1-Phe332 |
Peptide Sequence |
MGSSHHHHHHSSGLVPRGSHMATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.