« Zurück
Home /
LDH-A Recombinant Protein

LDH-A Recombinant Protein

ArtNr	PRS-91-215-0.05mg
Hersteller	ProSci
Menge	0.05 mg
Kategorie	Oncology By Cell Type Carcinoma Peptides & Proteins Recombinant Proteins Cell Biology Cell Status Necrosis Proliferation Toxicity & Cytotoxicity
Typ	Proteins Recombinant
Format	Liquid
Specific against	other
Dry ice	Yes
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	L-Lactate Dehydrogenase A Chain, LDH-A, Cell Proliferation-Inducing Gene 19 Protein, LDH Muscle Subunit, LDH-M, Renal Carcinoma Antigen NY-REN-59, LDHA, PIG19
Lieferbar
Applications	This recombinant protein can be used for biological assays. For research use only.
Applications	This recombinant protein can be used for biological assays. For research use only.
Buffer	Supplied as a 0.2 um filtered solution of 20mM TrisHCl, 100mM NaCl, 50% Glycerol, pH 8.0. It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Storage Conditions	Store at -20˚ C, stable for 6 months after receipt. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Disclaimer	Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.
Predicted Molecular Weight	38.8 kD
Purity	Greater than 95% as determined by reducing SDS-PAGE. Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Background	L-Lactate Dehydrogenase A Chain (LDHA) is an enzyme that catalyzes the conversion of L-lactate and NAD+ to pyruvate and NADH in the final step of anaerobic glycolysis. LDHA contains an N-terminal coenzyme binding region, a central catalytic site, and at least nine utilized Lys acetylation and two Tyr phosphorylation sites. LDHA belongs to the lactate dehydrogenase family, expressed predominantly in muscle tissue. LDHA mutations have been linked to exertional myoglobinuria.
Accession #	P00338
Ncbi Gene Id #	3939
Ncbi Official Symbol	LDHA
Ncbi Official Full Name	lactate dehydrogenase A
Ncbi Organism	Homo sapiens
Swissprot #	P00338
Fusion Tag	N-6 His tag
Sequence	Met1-Phe332
Peptide Sequence	MGSSHHHHHHSSGLVPRGSHMATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 0.05 mg

lieferbar

Lieferung vsl. bis 04.10.2024

Express-Lieferung: 8 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail