ArtNr |
PRS-91-196-0.05mg |
Hersteller |
ProSci
|
Menge |
0.05 mg |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid |
Specific against |
other |
Dry ice |
Yes
|
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Peptidyl-Prolyl Cis-Trans Isomerase E, PPIase E, Cyclophilin E, Cyclophilin-33, Rotamase E, PPIE, CYP33 |
Lieferbar |
|
Applications |
This recombinant protein can be used for biological assays. For research use only. |
Applications |
This recombinant protein can be used for biological assays. For research use only. |
Buffer |
Supplied as a 0.2 um filtered solution of 20mM TrisHCl, pH 8.0. It is not recommended to reconstitute to a concentration less than 100 ug/ml. |
Storage Conditions |
Store at -20˚ C, stable for 6 months after receipt. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Disclaimer |
Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures. |
Predicted Molecular Weight |
35.6 kD |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test. |
Background |
Peptidyl-prolyl cis-trans isomerase E, also known as Cyclophilin E, Cyclophilin-33, Rotamase E, CYP33, PPIE, is an enzyme which belongs to the cyclophilin-type PPIase family of PPIase E subfamily. PPIE found in all the examined tissues including heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. PPIE contains one PPIase cyclophilin-type domain and one RRM (RNA recognition motif) domain. PPIE accelerates the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. PPIE combines RNA-binding and PPIase activities. It may be involved in muscle- and brain-specific processes and pre-mRNA splici |
Accession # |
Q9UNP9 |
Ncbi Gene Id # |
10450 |
Ncbi Official Symbol |
PPIE |
Ncbi Official Full Name |
peptidylprolyl isomerase E |
Ncbi Organism |
Homo sapiens |
Swissprot # |
Q9UNP9 |
Fusion Tag |
N-6 His tag |
Sequence |
Met1-Val301 |
Peptide Sequence |
MGSSHHHHHHSSGLVPRGSHMATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVIIADCGEYV |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.