ArtNr |
PRS-91-167-0.05mg |
Hersteller |
ProSci
|
Menge |
0.05 mg |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid |
Specific against |
other |
Dry ice |
Yes
|
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Ubiquitin-Conjugating Enzyme E2 T, Cell Proliferation-Inducing Gene 50 Protein, Ubiquitin Carrier Protein T, Ubiquitin-Protein Ligase T, UBE2T, HSPC150 |
Lieferbar |
|
Applications |
This recombinant protein can be used for biological assays. For research use only. |
Applications |
This recombinant protein can be used for biological assays. For research use only. |
Buffer |
Supplied as a 0.2 um filtered solution of 50mM HEPES, 150mM NaCl, 2mM DTT, 10% Glycerol, pH 7.5. It is not recommended to reconstitute to a concentration less than 100 ug/ml. |
Storage Conditions |
Store at -20˚ C, stable for 6 months after receipt. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Disclaimer |
Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures. |
Predicted Molecular Weight |
24.7 kD |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test. |
Background |
Ubiquitin-Conjugating Enzyme E2 T (UBE2T) is a ligase that belongs to the Ubiquitin-Conjugating Enzyme family. UBE2T accepts the ATP-dependent ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro, UBE2T is able to catalyze polyubiquitination using all 7 ubiquitin Lys residues, but may prefer 'Lys-11'-, 'Lys-27'-, 'Lys-48'- and 'Lys-63'-linked polyubiquitination. UBE2T is an important factor of the Faconi anemia pathway of DNA damage repair and, upon self-inactivation, may negatively regulate the Faconi pathway. |
Accession # |
Q9NPD8 |
Ncbi Gene Id # |
29089 |
Ncbi Official Symbol |
UBE2T |
Ncbi Official Full Name |
ubiquitin conjugating enzyme E2 T |
Ncbi Organism |
Homo sapiens |
Swissprot # |
Q9NPD8 |
Fusion Tag |
N-6 His tag |
Sequence |
Met1-Val197 |
Protein Gi# |
78070603 |
Peptide Sequence |
MGSSHHHHHHSSGLVPRGSHMQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.