« Zurück
Home /
Recombinant Geobacillus stearothermophilus Glycerol-1-phosphate dehydrogenase [NAD(P)+](egsA)

Recombinant Geobacillus stearothermophilus Glycerol-1-phosphate dehydrogenase [NAD(P)+](egsA)

ArtNr	CSB-YP455307GFM-20
Hersteller	Cusabio
Menge	20ug
Kategorie	Metabolism Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research Areas	Others
Uniprot ID	B3EYN8
Gene Names	egsA
Organism	Geobacillus stearothermophilus (Bacillus stearothermophilus)
AA Sequence	MNQTLEEVVSLARQCGCGHRHYDIPIEQMVVGREA FARLVAYLRHKRYERVAIVADDHTFAAVERSLCDQ LENGSIRYTVCLVQPDENGDVIADERSIVQVLLET PDDVDVLIAVGAGTIHDITRFSSYKMRIPFISVPT APSVDGFTSMGAPLIIRGVKKTIQAQAPIAVFAHT GVLCQSPKEMIAAGFGDMVAKYTSLADWQFAHWMA DEPYCPFVHQLTEQSLQTCVDHIDDIAAGGEQGIR VLMDALLQSGIAMLLMGQSYSASGAEHHLSHYWEM EFLRQKKRQVLHGAKVGVSTPIIIEHYQRVFWPLL NELEKRPKSMDEATWERLKANTASIRELLESLPSP ERIRTMLAKVGGAIAPEQLGIDPQLVERSLREAHR LRLNRFTMLYFLNELIFVE
Expression Region	1-404aa
Sequence Info	Full Length
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	47.4 kDa
Alternative Name(s)	Enantiomeric glycerophosphate synthase sn-glycerol-1-phosphate dehydrogenase
Relevance	Catalyzes the NAD(P)H-dependent reduction of dihydroxyacetonephosphate (DHAP or glycerone phosphate) to glycerol 1-phosphate (G1P). The G1P thus generated is probably used for the synthesis of phosphoglycerolipids in Gram-positive bacterial species.
Reference	Hemicellulose utilization cluster in Geobacillus stearothermophilus strain T-6.Shoham Y., Shulami S., Ben-David A., Langut Y. Submitted (JUN-2008)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Catalyzes the NAD(P)H-dependent reduction of dihydroxyacetonephosphate (DHAP or glycerone phosphate) to glycerol 1-phosphate (G1P). The G1P thus generated is probably used for the synthesis of phosphoglycerolipids in Gram-positive bacterial species.
Subcellular Location	Cytoplasm
Protein Families	Glycerol-1-phosphate dehydrogenase family
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen