« Zurück
Home /
Recombinant Enterobacteria phage T7 Single-stranded DNA-binding protein gp2.5?2.5?

Recombinant Enterobacteria phage T7 Single-stranded DNA-binding protein gp2.5?2.5?

ArtNr	CSB-YP366021EEB-20
Hersteller	Cusabio
Menge	20ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research Areas	Others
Uniprot ID	P03696
Gene Names	2, 5
Organism	Enterobacteria phage T7 (Bacteriophage T7)
AA Sequence	MAKKIFTSALGTAEPYAYIAKPDYGNEERGFGNPR GVYKVDLTIPNKDPRCQRMVDEIVKCHEEAYAAAV EEYEANPPAVARGKKPLKPYEGDMPFFDNGDGTTT FKFKCYASFQDKKTKETKHINLVVVDSKGKKMEDV PIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESV MLVELATFGGGEDDWADEVEENGYVASGSAKASKP RDEESWDEDDEESEEADEDGDF
Expression Region	1-232aa
Sequence Info	Full Length
Source	Yeast
Tag Info	Tag-Free
MW	25.7 kDa
Relevance	Single-stranded DNA-binding protein that eliminates secondary structure in long ssDNA formed on the lagging strand of the replication fork. Stimulates DNA polymerase activity and increases the efficiency of RNA primer synthesis by interacting with the DNA polymerase and the helicase/primase protein gp4. Disrupts loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation.
Reference	Essential residues in the C terminus of the bacteriophage T7 gene 2.5 single-stranded DNA-binding protein.Marintcheva B., Hamdan S.M., Lee S.J., Richardson C.C.J. Biol. Chem. 281:25831-25840(2006)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Single-stranded DNA-binding protein that eliminates secondary structure in long ssDNA formed on the lagging strand of the replication fork. Stimulates DNA polymerase activity and increases the efficiency of RNA primer synthesis by interacting with the DNA polymerase and the helicase/primase protein gp4. Disrupts loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation.
Tag Information	Tag-Free

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen