ArtNr |
CSB-YP327013DUK-20 |
Hersteller |
Cusabio
|
Menge |
20ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
Yeast |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Lieferbar |
|
Research Areas |
Others |
Uniprot ID |
P30995 |
Gene Names |
N/A |
Organism |
Clostridium butyricum |
AA Sequence |
PTINSFNYNDPVNNRTILYIKPGGCQQFYKSFNIM KNIWIIPERNVIGTIPQDFLPPTSLKNGDSSYYDP NYLQSDQEKDKFLKIVTKIFNRINDNLSGRILLEE LSKANPYLGNDNTPDGDFIINDASAVPIQFSNGSQ SILLPNVIIMGAEPDLFETNSSNISLRNNYMPSNH GFGSIAIVTFSPEYSFRFKDNSMNEFIQDPALTLM HELIHSLHGLYGAKGITTKYTITQKQNPLITNIRG TNIEEFLTFGGTDLNIITSAQSNDIYTNLLADYKK IASKLSKVQVSNPLLNPYKDVFEAKYGLDKDASGI YSVNINKFNDIFKKLYSFTEFDLATKFQVKCRQTY IGQYKYFKLSNLLNDSIYNISEGYNINNLKVNFRG QNANLNPRIITPITGRGLVKKIIRFCKNIVSVKGI |
Expression Region |
2-422aa |
Sequence Info |
Partial |
Source |
Yeast |
Tag Info |
N-terminal 6xHis-tagged |
MW |
49.7 kDa |
Relevance |
Botulinum toxin acts by inhibiting neurotransmitter release. It binds to peripheral neuronal synapses, is internalized and moves by retrograde transport up the axon into the spinal cord where it can move between postsynaptic and presynaptic neurons. It inhibits neurotransmitter release by acting as a zinc endopeptidase. |
Reference |
Neurotoxin type E from Clostridium botulinum and C. butyricum; partial sequence and comparison.Gimenez J., Foley J., Dasgupta B.R.FASEB J. 2:A1750-A1750(1988) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Botulinum toxin acts by inhibiting neurotransmitter release. It binds to peripheral neuronal synapses, is internalized and moves by retrograde transport up the axon into the spinal cord where it can move between postsynaptic and presynaptic neurons. It inhibits neurotransmitter release by acting as a zinc endopeptidase. |
Subcellular Location |
Botulinum neurotoxin E light chain: Secreted, Host cytoplasm, host cytosol, SUBCELLULAR LOCATION: Botulinum neurotoxin E heavy chain: Secreted, Host cell junction, host synapse, host presynaptic cell membrane |
Protein Families |
Peptidase M27 family |
Tag Information |
N-terminal 6xHis-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.