« Zurück
Home /
Recombinant Mouse Mast cell protease 4(Mcpt4)

Recombinant Mouse Mast cell protease 4(Mcpt4)

ArtNr	CSB-YP325157MO-20
Hersteller	Cusabio
Menge	20ug
Kategorie	Oncology Peptides & Proteins Recombinant Proteins By Organ Lung Cancer
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research Areas	Cell Biology
Uniprot ID	P21812
Gene Names	Mcpt4
Organism	Mus musculus (Mouse)
AA Sequence	IIGGVESRPHSRPYMAHLEITTERGFTATCGGFLI TRQFVMTAAHCSGREITVTLGAHDVSKTESTQQKI KVEKQIVHPKYNFYSNLHDIMLLKLQKKAKETPSV NVIPLPRPSDFIKPGKMCRAAGWGRTGVTEPTSDT LREVKLRIMDKEACKNYWHYDYNLQVCVGSPRKKR SAYKGDSGGPLLCAGVAHGIVSYGRGDAKPPAVFT RISSYVPWINRVIKGE
Expression Region	21-246aa
Sequence Info	Full Length of Mature Protein
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	27.1 kDa
Alternative Name(s)	mMCP-4 MSMCP Myonase Serosal mast cell protease
Relevance	Has chymotrypsin-like activity. Hydrolyzes the amide bonds of synthetic substrates having Tyr and Phe residues at the P1 position. Preferentially hydrolyzes the 'Tyr-4-\|-Ile-5' bond of angiotensin I and the 'Phe-20-\|-Ala-21' bond of amyloid beta-protein, and is less active towards the 'Phe-8-\|-His-9' bond of angiotensin I and the 'Phe-4-\|-Ala-5' and 'Tyr-10-\|-Glu-11' bonds of amyloid beta-protein. Involved in thrombin regulation and fibronectin processing.
Reference	The chymase, mouse mast cell protease 4, constitutes the major chymotrypsin-like activity in peritoneum and ear tissue. A role for mouse mast cell protease 4 in thrombin regulation and fibronectin turnover.Tchougounova E., Pejler G., Abrink M.J. Exp. Med. 198:423-431(2003)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Has chymotrypsin-like activity. Hydrolyzes the amide bonds of synthetic substrates having Tyr and Phe residues at the P1 position. Preferentially hydrolyzes the 'Tyr-4-\|-Ile-5' bond of angiotensin I and the 'Phe-20-\|-Ala-21' bond of amyloid beta-protein, and is less active towards the 'Phe-8-\|-His-9' bond of angiotensin I and the 'Phe-4-\|-Ala-5' and 'Tyr-10-\|-Glu-11' bonds of amyloid beta-protein. Involved in thrombin regulation and fibronectin processing.
Protein Families	Peptidase S1 family, Granzyme subfamily
Tissue Specificity	Submucosal mast cells. In femoral muscle, detected in myocytes but not in mast cells.
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen