« Zurück
Home /
Recombinant Human Transcobalamin-1(TCN1)

Recombinant Human Transcobalamin-1(TCN1)

ArtNr	CSB-YP023317HU-20
Hersteller	Cusabio
Menge	20ug
Kategorie	Food Safety Vitamines Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	Human
Host	Yeast
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research Areas	Signal Transduction
Target / Protein	TCN1
Biologically Active	Not Test
Expression System	Yeast
Species of origin	Homo sapiens (Human)
Uniprot ID	P20061
AA Sequence	EICEVSEENYIRLKPLLNTMIQSNYNRGTSAVNVV LSLKLVGIQIQTLMQKMIQQIKYNVKSRLSDVSSG ELALIILALGVCRNAEENLIYDYHLIDKLENKFQA EIENMEAHNGTPLTNYYQLSLDVLALCLFNGNYST AEVVNHFTPENKNYYFGSQFSVDTGAMAVLALTCV KKSLINGQIKADEGSLKNISIYTKSLVEKILSEKK ENGLIGNTFSTGEAMQALFVSSDYYNENDWNCQQT LNTVLTEISQGAFSNPNAAAQVLPALMGKTFLDIN KDSSCVSASGNFNISADEPITVTPPDSQSYISVNY SVRINETYFTNVTVLNGSVFLSVMEKAQKMNDTIF GFTMEERSWGPYITCIQGLCANNNDRTYWELLSGG EPLSQGAGSYVVRNGENLEVRWSKY
Tag Info	N-terminal 6xHis-tagged
Expression Region	24-433aa
Protein Length	Full Length of Mature Protein
MW	47.6 kDa
Alternative Name(s)	Haptocorrin ; HCProtein RTranscobalamin I ; TC I ; TCI
Relevance	Binds vitamin B12 with ftomolar affinity and protects it from the acidic environment of the stomach.
Reference	Structure of the cDNA encoding transcobalamin I, a neutrophil granule protein.Johnston J., Bollekens J., Allen R.H., Berliner N.J. Biol. Chem. 264:15754-15757(1989)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Binds vitamin B12 with femtomolar affinity and protects it from the acidic environment of the stomach.
Subcellular Location	Secreted
Protein Families	Eukaryotic cobalamin transport proteins family
Tissue Specificity	Produced by the salivary glands of the oral cavity, in response to ingestion of food. Major constituent of secondary granules in neutrophils.
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen