« Zurück
Home /
Recombinant Human Galactocerebrosidase(GALC)

Recombinant Human Galactocerebrosidase(GALC)

ArtNr	CSB-YP009196HU-20
Hersteller	Cusabio
Menge	20ug
Quantity options	1mg 10ug 100ug 20ug 200ug 50ug 500ug
Kategorie	Oncology Peptides & Proteins Recombinant Proteins By Organ Colorectal Cancer
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research Areas	Cardiovascular
Uniprot ID	P54803
Gene Names	GALC
Organism	Homo sapiens (Human)
AA Sequence	YVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEP YRSQILDYLFKPNFGASLHILKVEIGGDGQTTDGT EPSHMHYALDENYFRGYEWWLMKEAKKRNPNITLI GLPWSFPGWLGKGFDWPYVNLQLTAYYVVTWIVGA KRYHDLDIDYIGIWNERSYNANYIKILRKMLNYQG LQRVKIIASDNLWESISASMLLDAELFKVVDVIGA HYPGTHSAKDAKLTGKKLWSSEDFSTLNSDMGAGC WGRILNQNYINGYMTSTIAWNLVASYYEQLPYGRC GLMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYY LKTVGHLEKGGSYVALTDGLGNLTIIIETMSHKHS KCIRPFLPYFNVSQQFATFVLKGSFSEIPELQVWY TKLGKTSERFLFKQLDSLWLLDSDGSFTLSLHEDE LFTLTTLTTGRKGSYPLPPKSQPFPSTYKDDFNVD YPFFSEAPNFADQTGVFEYFTNIEDPGEHHFTLRQ VLNQRPITWAADASNTISIIGDYNWTNLTIKCDVY IETPDTGGVFIAGRVNKGGILIRSARGIFFWIFAN GSYRVTGDLAGWIIYALGRVEVTAKKWYTLTLTIK GHFASGMLNDKSLWTDIPVNFPKNGWAAIGTHSFE FAQFDNFLVEATR
Expression Region	43-685aa
Sequence Info	Full Length of Mature Protein
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	74.8 kDa
Alternative Name(s)	Galactocerebroside beta-galactosidase Galactosylceramidase Galactosylceramide beta-galactosidase
Relevance	Hydrolyzes the galactose ester bonds of galactosylceramide, galactosylsphingosine, lactosylceramide, and monogalactosyldiglyceride. Enzyme with very low activity responsible for the lysosomal catabolism of galactosylceramide, a major lipid in myelin, kidney and epithelial cells of small intestine and colon.
Reference	Structure and organization of the human galactocerebrosidase (GALC) gene.Luzi P., Rafi M.A., Wenger D.A.Genomics 26:407-409(1995)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Hydrolyzes the galactose ester bonds of galactosylceramide, galactosylsphingosine, lactosylceramide, and monogalactosyldiglyceride. Enzyme with very low activity responsible for the lysosomal catabolism of galactosylceramide, a major lipid in myelin, kidney and epithelial cells of small intestine and colon.
Involvement in disease	Leukodystrophy, globoid cell (GLD)
Subcellular Location	Lysosome
Protein Families	Glycosyl hydrolase 59 family
Tissue Specificity	Detected in urine. Detected in testis, brain and placenta (at protein level). Detected in kidney and liver.
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen