« Zurück
Home /
Recombinant Human Inactive tyrosine-protein kinase transmembrane receptor ROR1(ROR1),partial (Active)

Recombinant Human Inactive tyrosine-protein kinase transmembrane receptor ROR1(ROR1),partial (Active)

ArtNr	CSB-MP020067HU1d7-20ug
Hersteller	Cusabio
Menge	20ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Lyophilized powder
Specific against	Human
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	(Neurotrophic tyrosine kinase, receptor-related 1)
Lieferbar
Gene Names	ROR1
Expression Region	30-403aa
Sequence Info	Partial
Tag Info	C-terminal 10xHis-tagged
AASequence	QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME
MW	44.8 kDa
Endotoxin	Less than 1.0 EU/ug as determined by LAL method.
Biological Activity	Measured by its binding ability in a functional ELISA. Immobilized ROR1 at 2 μg/mL can bind anti-ROR1 antibody（CSB-RA020067A1HU）, the EC50 is 0.2450-0.3416 ng/mL.
Activity Image Link	https://www.cusabio.com/uploadfile/protein/1/CSB-MP020067HU1d7-AC1.jpg
Buffer	Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance	Has very low kinase activity in vitro and is unlikely to function as a tyrosine kinase in vivo (PubMed:25029443). Receptor for ligand WNT5A which activate downstream NFkB signaling pathway and may result in the inhibition of WNT3A-mediated signaling (PubMed:25029443, PubMed:27162350). In inner ear, crucial for spiral ganglion neurons to innervate auditory hair cells (PubMed:27162350).

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen