« Zurück
Home /
Recombinant Human Interleukin-20 receptor subunit beta (IL20RB),partial

Recombinant Human Interleukin-20 receptor subunit beta (IL20RB),partial

ArtNr	CSB-EP740921HU-20
Hersteller	Cusabio
Menge	20ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Purity	Greater than 85% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research Areas	Cancer
Uniprot ID	Q6UXL0
Gene Names	IL20RB
Organism	Homo sapiens (Human)
AA Sequence	DEVAILPAPQNLSVLSTNMKHLLMWSPVIAPGETV YYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDV TDDITATVPYNLRVRATLGSQTSAWSILKHPFNRN STILTRPGMEITKDGFHLVIELEDLGPQFEFLVAY WRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVK AQTFVKAIGRYSAFSQTECVEVQGEAIPL
Expression Region	30-233aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	26.9 kDa
Alternative Name(s)	Fibronectin type III domain containing 6 (FNDC6) (IL-20 receptor subunit beta) (IL-20R-beta) (IL-20RB) (IL-20R2) (DIRS1)
Relevance	The IL20RA/IL20RB dimer is a receptor for IL19, IL20 and IL24. The IL22RA1/IL20RB dimer is a receptor for IL20 and IL24.
Reference	STAT activation by IL-19, IL-20 and mda-7 through IL-20 receptor complexes of two types. Dumoutier L., Leemans C., Lejeune D., Kotenko S.V., Renauld J.-C. J. Immunol. 167:3545-3549(2001)
Purity	Greater than 85% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen