ArtNr |
CSB-EP720181MOa2-100 |
Hersteller |
Cusabio
|
Menge |
100ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
Mouse |
Purity |
Greater than 85% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Lieferbar |
|
Research Areas |
Cancer |
Target / Protein |
Ripk1 |
Biologically Active |
Not Test |
Expression System |
E.coli |
Species of origin |
Mus musculus (Mouse) |
Uniprot ID |
Q60855 |
AA Sequence |
MQPDMSLDNIKMASSDLLEKTDLDSGGFGKVSLCY HRSHGFVILKKVYTGPNRAEYNEVLLEEGKMMHRL RHSRVVKLLGIIIEEGNYSLVMEYMEKGNLMHVLK TQIDVPLSLKGRIIVEAIEGMCYLHDKGVIHKDLK PENILVDRDFHIKIADLGVASFKTWSKLTKEKDNK QKEVSSTTKKNNGGTLYYMAPEHLNDINAKPTEKS DVYSFGIVLWAIFAKKEPYENVICTEQFVICIKSG NRPNVEEILEYCPREIISLMERCWQAIPEDRPTFL GIEEEFRPFYLSHFEEYVEEDVASLKKEYPDQSPV LQRMFSLQHDCVPLPPSRSNSEQPGSLHSSQGLQM GPVEESWFSSSPEYPQDENDRSVQAKLQEEASYHA FGIFAEKQTKPQPRQNEAYNREEERKRRVSHDPFA QQRARENIKSAGARGHSDPSTTSRGIAVQQLSWPA TQTVWNNGLYNQHGFGTTGTGVWYPPNLSQMYSTY KTPVPETNIPGSTPTMPYFSGPVADDLIKYTIFNS SGIQIGNHNYMDVGLNSQPPNNTCKEESTSRHQAI FDNTTSLTDEHLNPIRENLGRQWKNCARKLGFTES QIDEIDHDYERDGLKEKVYQMLQKWLMREGTKGAT VGKLAQALHQCCRIDLLNHLIRASQS |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
Expression Region |
1-656aa |
Protein Length |
Full Length |
MW |
87.8 kDa |
Alternative Name(s) |
Cell death protein RIP (Receptor-interacting protein 1) (RIP-1) (Rinp) (Rip) |
Relevance |
Serine-threonine kinase which transduces inflammatory and cell-death signals following death receptors ligation, activation of pathogen recognition receptors, and DNA damage. Upon activation of TNFR1 by the TNF-alpha family cytokines, TRADD and TRAF2 are recruited to the receptor. Phosphorylates DAB2IP at 'Ser-728' in a TNF-alpha-dependent manner, and thereby activates the MAP3K5-JNK apoptotic cascade. Ubiquitination by TRAF2 via 'Lys-63'-link chains acts as a critical enhancer of communication with downstream signal transducers in the mitogen-activated protein kinase pathway and the NF-kappa-B pathway, which in turn mediate downstream events including the activation of genes encoding inflammatory molecules. Polyubiquitinated protein binds to IKBKG/NEMO, the regulatory subunit of the IKK complex, a critical event for NF-kappa-B activation. Interaction with other cellular RHIM-containing adapters initiates gene activation and cell death. RIPK1 and RIPK3 association, in particular, forms a necrosis-inducing complex. |
Reference |
The death domain kinase RIP has an essential role in DNA damage-induced NF-kappa B activation. Hur G.M., Lewis J., Yang Q., Lin Y., Nakano H., Nedospasov S., Liu Z.G. Genes Dev. 17:873-882(2003) |
Purity |
Greater than 85% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.