Recombinant Bovine RISC-loading complex subunit TARBP2(TARBP2)

Microbiology

TARBP2

MSEEEQGSGTTTGCGLPSIEQMLAANPGKTPISLL QEYGTRIGKTPVYDLLKAEGQAHQPNFTFRVTVGD TSCTGQGPSKKAAKHKAAEVALKHLKGGSMLEPAL EDSSSFSPLDSSLPEDVPVFTAAAAATPVPSAVPT RSSPMEVQPPVSPQQSECNPVGALQELVVQKGWRL PEYTVTQESGPAHRKEFTMTCRVERFIEIGSGTSK KLAKRNAAAKMLLRVHTVPLDARDGNEAEPEDDHF SIGVGSRLDGLRNRGPGCTWDSLRNSVGEKILSLR SCSLGSLGALGPACCSVLSELSEEQAFHVSYLDIE ELSLSGLCQCLVELSTQPATVCHGSAATREAARGE AARRALQYLKIMAGSK

Full Length

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Required for formation of the RNA induced silencing complex (RISC). Component of the RISC loading complex (RLC), also known as the micro-RNA (miRNA) loading complex (miRLC), which is composed of DICER1, AGO2 and TARBP2. Within the RLC/miRLC, DICER1 and TARBP2 are required to process precursor miRNAs (pre-miRNAs) to mature miRNAs and then load them onto AGO2. AGO2 bound to the mature miRNA constitutes the minimal RISC and may subsequently dissociate from DICER1 and TARBP2. May also play a role in the production of short interfering RNAs (siRNAs) from double-stranded RNA (dsRNA) by DICER1.

Greater than 85% as determined by SDS-PAGE.

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.

Required for formation of the RNA induced silencing complex (RISC). Component of the RISC loading complex (RLC), also known as the micro-RNA (miRNA) loading complex (miRLC), which is composed of DICER1, AGO2 and TARBP2. Within the RLC/miRLC, DICER1 and TARBP2 are required to process precursor miRNAs (pre-miRNAs) to mature miRNAs and then load them onto AGO2. AGO2 bound to the mature miRNA constitutes the minimal RISC and may subsequently dissociate from DICER1 and TARBP2. May also play a role in the production of short interfering RNAs (siRNAs) from double-stranded RNA (dsRNA) by DICER1.

TARBP2 family