ArtNr |
CSB-EP356569EZB-20 |
Hersteller |
Cusabio
|
Menge |
20ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Konjugat/Tag |
Myc |
Purity |
Greater than 85% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Lieferbar |
|
Research Areas |
Others |
Target / Protein |
TLF1 |
Biologically Active |
Not Test |
Expression System |
E.coli |
Species of origin |
Protobothrops flavoviridis (Habu) (Trimeresurus flavoviridis) |
Uniprot ID |
P05620 |
AA Sequence |
VIGGDECNINEHPFLVALYDAWSGRFLCGGTLINP EWVLTAAHCDSKNFKMKLGAHSKKVLNEDEQIRNP KEKFICPNKKNDEVLDKDIMLIKLDSPVSYSEHIA PLSLPSSPPSVGSVCRIMGWGSITPVEETFPDVPH CANINLLDDVECKPGYPELLPEYRTLCAGVLQGGI DTCGFDSGTPLICNGQFQGIVSYGGHPCGQSRKPG IYTKVFDYNAWIQSIIAGNTAATCLP |
Tag Info |
N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Expression Region |
25-260aa |
Protein Length |
Full Length of Mature Protein |
MW |
33.1 kDa |
Alternative Name(s) |
Fibrinogen-clotting enzyme (Habutobin) (Snake venom serine protease 1) (SVSP) (SVTLE) |
Relevance |
Thrombin-like snake venom serine protease that clots fibrinogen by releasing fibrinopeptide A. According to PubMed:8585090, only cleaves rabbit fibrinogen, whereas no specificity is described in PubMed:3910643. Also acts as a C3 convertase that independently cleaves human C3 and kick-starts the complement cascade. Also increases urokinase-type plasminogen activator and plasminogen activator inhibitor in cultured bovine pulmonary artery endothelial cells. Dose-dependently inhibits collagen-induced platelet aggregation. |
Reference |
Habutobin releases plasminogen activator (U-PA) from bovine pulmonary artery endothelial cells. Sunagawa M., Hanashiro K., Nakamura M., Kosugi T. Toxicon 34:691-699(1996) |
Purity |
Greater than 85% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Tag Information |
N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.