« Zurück
Home /
Recombinant Protobothrops flavoviridis Thrombin-like enzyme flavoxobin(TLF1)

Recombinant Protobothrops flavoviridis Thrombin-like enzyme flavoxobin(TLF1)

ArtNr	CSB-EP356569EZB-20
Hersteller	Cusabio
Menge	20ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Konjugat/Tag	Myc
Purity	Greater than 85% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research Areas	Others
Target / Protein	TLF1
Biologically Active	Not Test
Expression System	E.coli
Species of origin	Protobothrops flavoviridis (Habu) (Trimeresurus flavoviridis)
Uniprot ID	P05620
AA Sequence	VIGGDECNINEHPFLVALYDAWSGRFLCGGTLINP EWVLTAAHCDSKNFKMKLGAHSKKVLNEDEQIRNP KEKFICPNKKNDEVLDKDIMLIKLDSPVSYSEHIA PLSLPSSPPSVGSVCRIMGWGSITPVEETFPDVPH CANINLLDDVECKPGYPELLPEYRTLCAGVLQGGI DTCGFDSGTPLICNGQFQGIVSYGGHPCGQSRKPG IYTKVFDYNAWIQSIIAGNTAATCLP
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region	25-260aa
Protein Length	Full Length of Mature Protein
MW	33.1 kDa
Alternative Name(s)	Fibrinogen-clotting enzyme (Habutobin) (Snake venom serine protease 1) (SVSP) (SVTLE)
Relevance	Thrombin-like snake venom serine protease that clots fibrinogen by releasing fibrinopeptide A. According to PubMed:8585090, only cleaves rabbit fibrinogen, whereas no specificity is described in PubMed:3910643. Also acts as a C3 convertase that independently cleaves human C3 and kick-starts the complement cascade. Also increases urokinase-type plasminogen activator and plasminogen activator inhibitor in cultured bovine pulmonary artery endothelial cells. Dose-dependently inhibits collagen-induced platelet aggregation.
Reference	Habutobin releases plasminogen activator (U-PA) from bovine pulmonary artery endothelial cells. Sunagawa M., Hanashiro K., Nakamura M., Kosugi T. Toxicon 34:691-699(1996)
Purity	Greater than 85% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Tag Information	N-terminal 10xHis-tagged and C-terminal Myc-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen