ArtNr |
CSB-EP313777ENV-100 |
Hersteller |
Cusabio
|
Menge |
100ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Konjugat/Tag |
Myc |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Lieferbar |
|
Research Areas |
Others |
Target / Protein |
rpoH |
Biologically Active |
Not Test |
Expression System |
E.coli |
Species of origin |
Escherichia coli (strain K12) |
Uniprot ID |
P0AGB3 |
AA Sequence |
MTDKMQSLALAPVGNLDSYIRAANAWPMLSADEER ALAEKLHYHGDLEAAKTLILSHLRFVVHIARNYAG YGLPQADLIQEGNIGLMKAVRRFNPEVGVRLVSFA VHWIKAEIHEYVLRNWRIVKVATTKAQRKLFFNLR KTKQRLGWFNQDEVEMVARELGVTSKDVREMESRM AAQDMTFDLSSDDDSDSQPMAPVLYLQDKSSNFAD GIEDDNWEEQAANRLTDAMQGLDERSQDIIRARWL DEDNKSTLQELADRYGVSAERVRQLEKNAMKKLRA AIEA |
Tag Info |
N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Expression Region |
1-284aa |
Protein Length |
Full Length |
MW |
39.9 kDa |
Alternative Name(s) |
Heat shock regulatory protein F33.4 (RNA polymerase sigma-32 factor) (fam) (hin) (htpR) |
Relevance |
Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. This sigma factor is involved in regulation of expression of heat shock genes. Intracellular concentration of free RpoH protein increases in response to heat shock, which causes association with RNA polymerase and initiation of transcription of heat shock genes, including numerous global transcriptional regulators and genes involved in maintaining membrane functionality and homeostasis. RpoH is then quickly degraded, leading to a decrease in the rate of synthesis of heat shock proteins and shut-off of the heat shock response. |
Reference |
The complete genome sequence of Escherichia coli K-12. Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose D.J., Mau B., Shao Y. Science 277:1453-1462(1997) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Tag Information |
N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.