« Zurück
Home /
Recombinant Human Myosin-9(MYH9) ,partial

Recombinant Human Myosin-9(MYH9) ,partial

ArtNr	CSB-EP015303HUe0-20
Hersteller	Cusabio
Menge	20ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	Human
Konjugat/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research Areas	Cell Cycle
Target / Protein	MYH9
Biologically Active	Not Test
Expression System	E.coli
Species of origin	Homo sapiens (Human)
Uniprot ID	P35579
AA Sequence	AQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPS DKSGFEPASLKEEVGEEAIVELVENGKKVKVNKDD IQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYY SGLIYTYSGLFCVVINPYKNLPIYSEEIVEMYKGK KRHEMPPHIYAITDTAYRSMMQDREDQSILCTGES GAGKTENTKKVIQYLAYVASSHKSKKDQGELERQL LQANPILEAFGNAKTVKNDNSSRFGKFIRI
Tag Info	N-terminal GST-tagged
Expression Region	2-241aa
Protein Length	Partial
MW	54.2 kDa
Alternative Name(s)	Cellular myosin heavy chain, type AMyosin heavy chain 9Myosin heavy chain, non-muscle IIaNon-muscle myosin heavy chain A ; NMMHC-ANon-muscle myosin heavy chain IIa ; NMMHC II-a ; NMMHC-IIA
Relevance	Cellular myosin that appears to play a role in cytokinesis, cell shape, and specialized functions such as secretion and capping. During cell spreading, plays an important role in cytoskeleton reorganization, focal contacts formation (in the margins but not the central part of spreading cells), and lamellipodial retraction; this function is mechanically antagonized by MYH10.
Reference	A genome annotation-driven approach to cloning the human ORFeome.Collins J.E., Wright C.L., Edwards C.A., Davis M.P., Grinham J.A., Cole C.G., Goward M.E., Aguado B., Mallya M., Mokrab Y., Huckle E.J., Beare D.M., Dunham I.Genome Biol. 5:R84.1-R84.11(2004)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Cellular myosin that appears to play a role in cytokinesis, cell shape, and specialized functions such as secretion and capping. During cell spreading, plays an important role in cytoskeleton reorganization, focal contacts formation (in the margins but not the central part of spreading cells), and lamellipodial retraction; this function is mechanically antagonized by MYH10.
Involvement in disease	May-Hegglin anomaly (MHA); Sebastian syndrome (SBS); Fechtner syndrome (FTNS); Epstein syndrome (EPSTNS); Deafness, autosomal dominant, 17 (DFNA17); Macrothrombocytopenia and progressive sensorineural deafness (MPSD)
Subcellular Location	Cytoplasm, cytoskeleton, Cytoplasm, cell cortex
Protein Families	TRAFAC class myosin-kinesin ATPase superfamily, Myosin family
Tissue Specificity	In the kidney, expressed in the glomeruli. Also expressed in leukocytes.
Paythway	Regulationofactincytoskeleton
Tag Information	N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen