Vergleich

LR3 IGF1 Human Europäischer Partner

ArtNr BNTH-CYT-022-0,2mg
Hersteller BIOSYNTH
Menge 0.2 mg
Quantity options 1 mg
Kategorie
Typ Proteins
Specific against other
Host E.coli
Purity Greater than 95.0% as determined by SDS-PAGE and HPLC.
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Lieferbar
Manufacturer - Category
Life Sciences / Peptides and Biochemicals / Research Peptides
Shipping Temperature
No Dry Ice
Storage Conditions
-20 C
Model
LR3 IGF1 Human
Description
IGF-1 (Insulin-like growth factor-1) is a major hormonal mediator of statural growth. Under regular circumstances, GH (growth hormone) binds to its receptor in the liver, and other tissues, and stimulates the synthesis/secretion of IGF-1. In target tissues, the Type 1 IGF receptor, that is homologous to the insulin receptor, is activated by IGF-1, leading to intracellular signaling which stimulates multiple processes leading to statural growth. IGF-1 metabolic actions are partly directed at stimulating the uptake of glucose, fatty acids, and amino acids so that metabolism supports growing tissues.Description: The LR3 is a long-term analog of human IGF-1, specifically designed and manufactured for mammalian cell culture to support large-scale manufacturing of recombinant biopharmaceuticals. Recombinant Human LR3 Insulin Like Growth Factor-1 produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 83 amino acids and having a molecular mass of 9.1kDa.Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.Formulation: Lyophilized from a 0.2µ m filtered concentrated solution in 1xPBS.Solubility: It is recommended to reconstitute the lyophilized LR3 IGF1 in sterile 18M-cm H2O at a concentration of 100µ g/ml, which can then be further diluted to other aqueous solutions.Stability: Lyophilized LR3 IGF1 although stable at room temperature for 3 weeks, should be stored desiccated below -18° C. Upon reconstitution the LR3 IGF1 should be stored at 4° C between 2-7 days and for future use below -18° C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.Biological Activity: The ED50 as determined by the stimulation of protein synthesis in L6 myoblasts is less than 10ng/ml, corresponding to a specific activity of 100, 000units/mg.
One letter code
MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 0.2 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen