« Zurück
Home /
Recombinant Human Lipopolysaccharide-binding protein (LBP), partial

Recombinant Human Lipopolysaccharide-binding protein (LBP), partial

ArtNr	BM-RPC28739-1mg
Hersteller	Biomatik
Menge	1mg
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Protein Type	Recombinant Protein
Gene Name	LBP
Alternative Names	Lipopolysaccharide-binding protein(LBP)
Uniprot	P18428
Expression Region	304-414aa
AA Sequence	TDDMIPPDSNIRLTTKSFRPFVPRLARLYPNMNLELQGSVPSAPLLNFSPGNLSVDPYMEIDAFVLLPSSSKEPVFRLSVATNVSATLTFNTSKITGFLKPGKVKVELKES
Sequence Info	Partial
Tag Info	N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
Theoretical MW	47.4 kDa
Purity	Greater than 85% as determined by SDS-PAGE.
Storage Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not Tested
Shipping Condition	Ice packs
Storage	Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Expiry Date	1 year
Research Area	Immunology
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Plays a role in the innate immune response. Binds to the lipid A moiety of bacterial lipopolysaccharides (LPS), a glycolipid present in the outer membrane of all Gram-negative bacteria (PubMed:7517398, PubMed:24120359). Acts as an affinity enhancer for CD14, facilitating its association with LPS. Promotes the release of cytokines in response to bacterial lipopolysaccharide (PubMed:7517398, PubMed:24120359).

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Lieferung vsl. bis 30.08.2024

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern