« Zurück
Home /
Recombinant Human Granulysin

Recombinant Human Granulysin

ArtNr	pro-852-10ug
Hersteller	ProSpec
Menge	10ug
Kategorie	Neuroscience Neural Lineage Markers Neuroinflammation Neural Mitochondrial Function Neural Signaling Peptides & Proteins Recombinant Proteins
Typ	Proteins
Specific against	Human
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Similar products	GNLY
Lieferbar
Synonyms	LAG2, Lymphokine LAG-2, TLA519, NKG5, LAG2, D2S69E, Granulysin, T-cell activation protein 519, GNLY, D2S69E
Introduction	GNLY is part of the SAPLIP family and is located in the cytotoxic granules of T cells, which are discharged upon antigen stimulation. GNLY is localized in cytotoxic granules of cytotoxic T lymphocytes and natural killer cells, and it has antimicrobial activity against M. tuberculosis and other organisms. GNLY is an antimicrobial protein that kills intracellular pathogens. GNLY is active against a wide range of microbes, including Gram-positive and Gram-negative bacteria, fungi, and parasites. Kills Mycobacterium tuberculosis.
Description	GNLY Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 159 amino acids and fused to a double His Tag (N+C terminus) and having a total molecular mass of 18.1 kDa. The GNLY is purified by proprietary chromatographic techniques.
Source	Escherichia Coli.
Physical Appearance	Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation	The Granulysin protein was lyophilized from a concentrated (1mg/ml) solution containing no additives.
Purity	Greater than 95.0% as determined by SDS-PAGE.
Usage	ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Amino acid sequence	MGSSHHHHHH SSGLVPRGSHMMEGLVFSRLSPEYYD LARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYR TCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWR DVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPS TGPLGS HHHHHH .
Storage	Lyophilized Granulysin although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution Granulysin should be stored at 4C between 2-7 days and for future use below -18C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.