Vergleich

Recombinant Human CD8a Protein Europäischer Partner

ArtNr RP01522-10ug
Hersteller Abclonal
Menge 10 ug
Kategorie
Typ Proteins Recombinant
Specific against Human
Purity > 95% by SDS-PAGE.
Sequence SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD
NCBI CD8a
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias CD8,CD8 alpha,Leu-2,Leu2,MAL,p32
Lieferbar
Description
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Background
T-cell surface glycoprotein CD8 alpha chain, also known as CD8a, is a single-pass type I membrane protein. The CD8 glycoprotein is expressed by thymocytes, mature T cells and natural killer (NK) cells and has been implicated in the recognition of monomorphic determinants on major histocompatibility complex (MHC) Class I antigens, and in signal transduction during the course of T-cell activation. Both human and rodent CD8 antigens are comprised of two distinct polypeptide chains, alpha and beta. The Ig domains of CD8 alpha are involved in controlling the ability of CD8 to be expressed. Mutation of B- and F-strand cysteine residues in CD8 alpha reduced the ability of the protein to fold properly and, therefore, to be expressed. Defects in CD8A are a cause of familial CD8 deficiency. Familial CD8 deficiency is a novel autosomal recessive immunologic defect characterized by absence of CD8+ cells, leading to recurrent bacterial infections.
Route
C-raFc
Manufacturers Category
Proteins
Endotoxin
<0.1EU/μg
Immunogen
Ser22-Asp182
Storage
Store the lyophilized protein at -20°C to -80°C for 12 months.|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Manufacturers Research Area
Other Recombinant Protein
Gene Symbol
CD8a
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Protein Description
Recombinant Human CD8a Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser22-Asp182) of human CD8a (Accession #NP_001139345.1) fused with a raFc tag at the C-terminus.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen