« Zurück
Home /
Recombinant Human LILRA6/ILT-8 Protein

Recombinant Human LILRA6/ILT-8 Protein

ArtNr	RP01453-50ug
Hersteller	Abclonal
Menge	50 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Human
Purity	> 95% by SDS-PAGE.
Sequence	GPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYQLDKEGSPEPLDRNNPLEPKNKARFSIPSMTQHHAGRYRCHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVTPSHRWRFTCYYYYTNTPRVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYDRFVLYKEGERDFLQRPGQQPQAGLSQ
NCBI	LILRA6/ILT-8
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	ILT5;ILT8;CD85b;ILT-8;LILRB3;LILRB6
Lieferbar
Description	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Background	The LILRs are a family of receptors that regulate the activities of myelomonocytic cells. LILRB3 and LILRA6 represent a pair of inhibitory/activating receptors with identical extracellular domains and unknown ligands. LILRB3 (ILT5) and LILRA6 (ILT8) are highly polymorphic receptors with similar extracellular domains. LILRA6 can signal through association with an activating adaptor molecule, FcRγ, which bears a cytoplasmic tail with an immunoreceptor tyrosine-based activation motif. Analysis of mRNA expression in the major fractions of PBMCs showed that LILRA6 is primarily expressed in monocytes, and its expression level correlates with copy number of the gene.
Route	C-His&Avi
Manufacturers Category	Proteins
Endotoxin	<0.1EU/μg
Immunogen	Gly24-Asn447
Storage	Store the lyophilized protein at -20°C to -80°C for long term.\|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Manufacturers Research Area	Other Recombinant Protein
Gene Symbol	LILRA6/ILT-8
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Protein Description	Recombinant Human LILRA6/ILT-8 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly24-Asn447) of human LILRA6/CD85b/ILT8 (Accession #CCDS42610.1) fused with a 6×His，Avi tag at the C-terminus.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 27.09.2024

Express-Lieferung: 31 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail