Vergleich

Recombinant Mouse TPO/Thrombopoietin/THPO Protein Europäischer Partner

ArtNr RP00777-10ug
Hersteller Abclonal
Menge 10 ug
Quantity options 1000 ug 10 ug 500 ug 50 ug
Kategorie
Typ Proteins Recombinant
Purity > 95% by SDS-PAGE.
Sequence SPVAPACDPRLLNKLLRDSHLLHSRLSQCPDVDPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPLQGRTTAHKDPNALFLSLQQLLRGKVRFLLLVEGPTLCVRRTLPTTAVPSSTSQLLTLNKFPNRTSGLLETNFSVTARTAGPGLLSRLQGFRVKITPGQLNQTSRSPVQISGYLNRTHGPVNGTHGLFAGTSLQTLEASDIS
NCBI TPO/Thrombopoietin/THPO
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Thrombopoietin,C-mpl ligand,Megakaryocyte colony-stimulating factor,Megakaryocyte growthand development factor,Myeloproliferative leukemia virus oncogene ligand,THPO
Lieferbar
Manufacturer - Category
Proteins
Storage Conditions
Store the lyophilized protein at -20°C to -80 °C for long term.
After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Description
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Background
Thrombopoietin (TPO) is a glycoprotein hormone which belongs to the EPO/TPO family. It produced by theliver and kidney which regulates the production of platelets.Mature mouse Tpo shares 71% and 81% aasequence homology with human and rat Tpo, respectively. It is an 80-85 kDa protein that consists of an N-terminal domain with homology to Erythropoietin (Epo) and a C-terminal domain that contains multiple N-linked and O-linked glycosylation sites. TPO stimulates the production and differentiation of megakaryocytes, the bone marrow cells that bud off large numbers of platelets. Lineage-specific cytokine affects theproliferation and maturation of megakaryocytes from their committed progenitor cells. It acts at a late stage ofmegakaryocyte development. It may be the major physiological regulator of circulating platelets.
Immunogen
Ser22-Thr356
Route
C-6xHis
Endotoxin
< 1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Cytokines & Cytokine Receptors
Protein Formulation
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen