« Zurück
Home /
Anti-LI Cadherin Antibody [ARC1989]

Anti-LI Cadherin Antibody [ARC1989]

ArtNr	ANTI-A307438-50
Hersteller	Antibodies.com
Menge	50ul
Format	Liquid
Applikationen	WB, IHC, ICC
Clon	ARC1989
Specific against	Human, Mouse, Rat
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Formula	Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Sequence	MILQAHLHSLCLLMLYLATGYGQEGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTFELTGETDNIFVIEREGLLYYNRALDRETRSTHNLQVAALD
Lieferbar
Product Description	Rabbit monoclonal [ARC1989] antibody to LI Cadherin.
Clonality	Monoclonal
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LI Cadherin/Cadherin-17 (Q12864).
Product form	Liquid
Molecular weight	120 kDa
Formulation	Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Purification	Affinity purification.
Storage	Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Recommended dilutions	WB: 1:500-1:2, 000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200
Target	LI Cadherin

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ul

lieferbar

Lieferung vsl. bis 23.08.2024

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail