« Zurück
Home /
Anti-Pigu Antibody

Anti-Pigu Antibody

ArtNr	ANTI-A306810-100
Hersteller	Antibodies.com
Menge	100ul
Format	Liquid
Applikationen	WB, IHC, ICC
Specific against	Human, Mouse, Rat
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Formula	Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Sequence	MAAPLVLVLVVAVTVRAALFRSSLAEFISERVEVVSPLSSWKRVVEGLSLLDLGVSPYSGAVFHETPLIIYLFHFLIDYAELVFMITDALTAIALYFAIQ
Lieferbar
Product Description	Rabbit polyclonal antibody to Pigu.
Clonality	Polyclonal
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PIGU (NP_536724.1).
Product form	Liquid
Molecular weight	50 kDa
Formulation	Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Purification	Affinity purification.
Storage	Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Recommended dilutions	WB: 1:500-1:2, 000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200
Target	Pigu

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ul

lieferbar

Lieferung vsl. bis 06.09.2024

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern