« Zurück
Home /
Anti-SARS spike glycoprotein RBD Antibody [ARC52570]

Anti-SARS spike glycoprotein RBD Antibody [ARC52570]

ArtNr	ANTI-A305296-50
Hersteller	Antibodies.com
Menge	50ul
Format	Liquid
Applikationen	WB
Clon	ARC52570
Specific against	other
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Formula	Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.05% Proclin 300.
Sequence	ADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRP
Lieferbar
Product Description	Rabbit monoclonal [ARC52570] antibody to SARS spike glycoprotein RBD.
Clonality	Monoclonal
Reactivity	SARS-CoV
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 350-450 of coronavirus SARS-CoV Spike RBD (NP_828851.1).
Product form	Liquid
Molecular weight	181 kDa
Formulation	Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.05% Proclin 300.
Purification	Affinity purification.
Storage	Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Recommended dilutions	WB: 1:1, 000-1:5, 000
Target	SARS spike glycoprotein RBD

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ul

lieferbar

Lieferung vsl. bis 11.10.2024

Express-Lieferung: 11 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail