« Zurück
Home /
GITR Ligand/TNFSF18 Rabbit pAb

GITR Ligand/TNFSF18 Rabbit pAb

ArtNr	A7028-500uL
Hersteller	Abclonal
Menge	500 uL
Kategorie	Antibodies Primary Antibodies
Typ	Antibody Polyclonal
Applikationen	WB, ELISA
Specific against	Human
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	CSIVMLLFLCSFSWLIFIFLQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSE
NCBI	TNFSF18
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	TNFSF18;AITRL;GITRL;TL6;TNLG2A;hGITRL
Lieferbar
Background	The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptor TNFRSF18/AITR/GITR. It has been shown to modulate T lymphocyte survival in peripheral tissues. This cytokine is also found to be expressed in endothelial cells, and is thought to be important for interaction between T lymphocytes and endothelial cells.
Route	Recombinant protein
Manufacturers Category	Polyclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 52-177 of human GITR Ligand/TNFSF18 (NP_005083.2).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:1000 - 1:5000
Protein Size	20kDa
Manufacturers Research Area	Cancer, Signal Transduction, Cell Biology Developmental Biology, Apoptosis, Growth factors, Immunology Inflammation, Cytokines, Cell Intrinsic Innate Immunity Signaling Pathway, Cardiovascular
Gene Symbol	TNFSF18

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500 uL

lieferbar

Lieferung vsl. bis 27.09.2024

Express-Lieferung: 21 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail