Vergleich

p53 Rabbit pAb Europäischer Partner

ArtNr A5804-1000uL
Hersteller Abclonal
Menge 1000 uL
Kategorie
Typ Antibody Polyclonal
Applikationen WB, ELISA
Specific against Mouse
Isotype IgG
Konjugat/Tag Unconjugated
Purity Affinity purification
Sequence PSQKTYQGNYGFHLGFLQSGTAKSVMCTYSPPLNKLFCQLAKTCPVQLWVSATPPAGSRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNLYPEYLEDRQTFRHSVVVPYEPPEAGSEYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEVLCPELPPGSAKRALPTCTSASPPQKKKPLDGEYFTLKIRGRKRFEMFRELNEALELKD
NCBI Trp53
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias TP53;BCC7;LFS1;P53;TRP53;Trp53;bbl;bfy;bhy;p44;p53;Tp53
Lieferbar
Background
This gene encodes tumor protein p53, which responds to diverse cellular stresses to regulate target genes that induce cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. p53 protein is expressed at low level in normal cells and at a high level in a variety of transformed cell lines, where it's believed to contribute to transformation and malignancy. p53 is a DNA-binding protein containing transcription activation, DNA-binding, and oligomerization domains. It is postulated to bind to a p53-binding site and activate expression of downstream genes that inhibit growth and/or invasion, and thus function as a tumor suppressor. Mice deficient for this gene are developmentally normal but are susceptible to spontaneous tumors. Evidence to date shows that this gene contains one promoter, in contrast to alternative promoters of the human gene, and transcribes a few of splice variants which encode different isoforms, although the biological validity or the full-length nature of some variants has not been determined.
Route
Recombinant protein
Manufacturers Category
Polyclonal Antibodies
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 95-390 of mouse p53 (NP_035770.2).
Storage
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Recommended Dilution
WB, 1:500 - 1:2000
Protein Size
43kDa
Manufacturers Research Area
Epigenetics & Nuclear Signaling, Transcription Factors, DNA Damage & Repair, Cancer, Tumor suppressors, p53 pathway, Signal Transduction, PI3K-Akt Signaling Pathway, ErbB-HER Signaling Pathway, MAPK-JNK Signaling Pathway, MAPK-P38 Signaling Pathway, Cell Biology & Developmental Biology, Apoptosis, Mitochondrial Control of Apoptosis, Cell Cycle, Cell cycle inhibitors, G1/S Checkpoint, G2/M DNA Damage Checkpoint, Endocrine & Metabolism, AMPK Signaling Pathway, Warburg Effect, Neuroscience, Neurodegenerative Diseases
Gene Symbol
Trp53

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1000 uL
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen