Vergleich

DiMethyl-Histone H3-K36 Rabbit mAb Europäischer Partner

ArtNr A22087-1000uL
Hersteller Abclonal
Menge 1000 uL
Kategorie
Typ Antibody Monoclonal
Applikationen WB, IF, IP, ICC, ELISA, IHC-P, Dot
Specific against Human
Isotype IgG
Konjugat/Tag Unconjugated
Purity Affinity purification
Sequence MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
NCBI Histone H3
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias H3.4;H3/g;H3FT;H3t;HIST3H3;Histone H3;HIST1H3A
Lieferbar
Background
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is located separately from the other H3 genes that are in the histone gene cluster on chromosome 6p22-p21.3.
Route
Synthetic peptide
Manufacturers Category
Methylated Antibodies
Immunogen
A synthetic dimethylated peptide around K36 of human Histone H3 (NP_003520.1).
Storage
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Recommended Dilution
DB, 1:2000 - 1:10000|WB, 1:2000 - 1:10000|IHC-P, 1:1000 - 1:5000|IF/ICC, 1:50 - 1:200|IP, 1:2000 - 1:10000
Protein Size
16kDa
Manufacturers Research Area
Epigenetics Nuclear Signaling, Protein phosphorylation, Signal Transduction, MAPK-Erk Signaling Pathway
Gene Symbol
Histone H3

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1000 uL
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen