Vergleich

Pan Cadherin Rabbit pAb Europäischer Partner

ArtNr A18682-1000uL
Hersteller Abclonal
Menge 1000 uL
Kategorie
Typ Antibody Polyclonal
Applikationen WB, IP, ELISA
Specific against Human
Isotype IgG
Purity Affinity purification
Sequence RPANPDEIGNFIDENLKAADTDPTAPPYDSLLVFDYEGSGSEAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGEDD
NCBI CDH1/CDH2/CDH3/CDH4
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias CDH1/CDH2/CDH3/CDH4
Lieferbar
Background
Cadherin is one of a class of integral-membrane glycoproteins that are involved in cell to cell attachment for preserving the integrity of all solid tissues. Cadherins have three major regions: the Ca2+ -dependent extracellular region that mediates adhesion (cadherin to cadherin) for cell to cell binding; the transmembrane region; and the cytoplasmic region that extends into the cell and interacts with catenins, which in turn are linked to the actin of the cytoskeleton. Cadherins are differentially expressed during development and in adult organs. Since many cell types express multiple cadherin subclasses simultaneously (the combination differs with cell type), it can be inferred that the adhesion properities of individual cells are thus governed by varying the combinations of cadherins. Altered expression of cadherins are involved in invasion and metastasis of tumour cells. The classical cadherins (e.g. E-, N-, and P-cadherins) are the most common family members. E-cadherin (also known as uvomorulin) is concentrated in the belt desmosome in epithelial cells; N-cadherin is found in nerve, muscle, and lens cells and helps maintain the integrity of neuronal aggregates; P-cadherin is expressed in placental and epidermal cells.
Route
Synthetic peptide
Manufacturers Category
Polyclonal Antibodies
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 800-882 of human pan-cadherin (NP_004351.1).
Storage
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Recommended Dilution
WB, 1:500 - 1:2000|IP, 1:1000 - 1:5000
Gene Symbol
CDH1/CDH2/CDH3/CDH4

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1000 uL
Lieferbar: In stock
lieferbar

Lieferung vsl. bis 23.08.2024 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen