ArtNr |
A1781-500uL |
Hersteller |
Abclonal
|
Menge |
500 uL |
Kategorie |
|
Typ |
Antibody Polyclonal |
Applikationen |
WB, IF, IP, ICC, ELISA |
Specific against |
Human |
Isotype |
IgG |
Konjugat/Tag |
Unconjugated |
Purity |
Affinity purification |
Sequence |
MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALI |
NCBI |
AKR1C3 |
ECLASS 10.1 |
32160702 |
ECLASS 11.0 |
32160702 |
UNSPSC |
12352203 |
Alias |
AKR1C3;DD3;DDX;HA1753;HAKRB;HAKRe;HSD17B5;PGFS;hluPGFS |
Lieferbar |
|
Background |
This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reduction of prostaglandin (PG) D2, PGH2 and phenanthrenequinone (PQ), and the oxidation of 9alpha, 11beta-PGF2 to PGD2. It may play an important role in the pathogenesis of allergic diseases such as asthma, and may also have a role in controlling cell growth and/or differentiation. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. Three transcript variants encoding different isoforms have been found for this gene. |
Route |
Recombinant protein |
Manufacturers Category |
Polyclonal Antibodies |
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-323 of human AKR1C3 (NP_003730.4). |
Storage |
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Recommended Dilution |
WB, 1:500 - 1:1000|IF/ICC, 1:50 - 1:200|IP, 1:50 - 1:100 |
Protein Size |
37kDa |
Manufacturers Research Area |
Cancer, Signal Transduction, Cell Biology Developmental Biology, Growth factors, Endocrine Metabolism, Neuroscience |
Gene Symbol |
AKR1C3 |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.