ArtNr |
A17038-1000uL |
Hersteller |
Abclonal
|
Menge |
1000 uL |
Kategorie |
|
Typ |
Antibody Polyclonal |
Applikationen |
WB, IF, IP, ICC, ELISA |
Specific against |
Human |
Isotype |
IgG |
Purity |
Affinity purification |
Sequence |
TQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPAD |
NCBI |
NR1I2 |
ECLASS 10.1 |
32160702 |
ECLASS 11.0 |
32160702 |
UNSPSC |
12352203 |
Alias |
NR1I2;BXR;ONR1;PAR;PAR1;PAR2;PARq;PRR;PXR;SAR;SXR |
Lieferbar |
|
Background |
This gene product belongs to the nuclear receptor superfamily, members of which are transcription factors characterized by a ligand-binding domain and a DNA-binding domain. The encoded protein is a transcriptional regulator of the cytochrome P450 gene CYP3A4, binding to the response element of the CYP3A4 promoter as a heterodimer with the 9-cis retinoic acid receptor RXR. It is activated by a range of compounds that induce CYP3A4, including dexamethasone and rifampicin. Several alternatively spliced transcripts encoding different isoforms, some of which use non-AUG (CUG) translation initiation codon, have been described for this gene. Additional transcript variants exist, however, they have not been fully characterized. |
Route |
Recombinant Protein |
Manufacturers Category |
Polyclonal Antibodies |
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 135-230 of human PXR (NP_003880.3). |
Storage |
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Recommended Dilution |
WB, 1:100 - 1:500|IF/ICC, 1:50 - 1:200|IP, 1:100 - 1:500 |
Protein Size |
50kDa |
Manufacturers Research Area |
Epigenetics Nuclear Signaling, Transcription Factors, Nuclear Receptor Signaling, Cancer, Signal Transduction, Cell Biology Developmental Biology, Growth factors, Endocrine Metabolism, Drug metabolism |
Gene Symbol |
NR1I2 |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.