« Zurück
Home /
DLG3 Rabbit pAb

DLG3 Rabbit pAb

ArtNr	A16831-500uL
Hersteller	Abclonal
Menge	500 uL
Kategorie	Antibodies Primary Antibodies
Typ	Antibody Polyclonal
Applikationen	WB, ELISA, IHC-P
Specific against	Human
Isotype	IgG
Purity	Affinity purification
Sequence	QYRPEEYSRFESKIHDLREQMMNSSMSSGSGSLRTSEKRSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGESEQIGVIPSKKRVEKKERARLKTVKFHARTGMIESNRDFPGLSDDYYGAKNLKGQEDAILSYEPVTRQEIHYARPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQFNDNLYGTSIQSVRAVAERGKH
NCBI	DLG3
ECLASS 5.1	32160702
ECLASS 6.1	32160702
ECLASS 8.0	32160702
ECLASS 9.0	32160702
ECLASS 10.0.1	32160702
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	DLG3;MRX;MRX90;NEDLG;PPP1R82;SAP102;XLMR
Lieferbar
Background	This gene encodes a member of the membrane-associated guanylate kinase protein family. The encoded protein may play a role in clustering of NMDA receptors at excitatory synapses. It may also negatively regulate cell proliferation through interaction with the C-terminal region of the adenomatosis polyposis coli tumor suppressor protein. Mutations in this gene have been associated with X-linked cognitive disability. Alternatively spliced transcript variants have been described.
Route	Recombinant Protein
Manufacturers Category	Polyclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 464-817 of human DLG3 (NP_066943.2).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:2000\|IHC-P, 1:100 - 1:200
Protein Size	90kDa
Manufacturers Research Area	Neuroscience, Cell Type Marker, Neuron marker, Synapse marker
Gene Symbol	DLG3

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500 uL

lieferbar

Lieferung vsl. bis 23.08.2024

Express-Lieferung: 14 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail