« Zurück
Home /
RTN1 Rabbit pAb

RTN1 Rabbit pAb

ArtNr	A16427-1000uL
Hersteller	Abclonal
Menge	1000 uL
Kategorie	Antibodies Primary Antibodies
Typ	Antibody Polyclonal
Applikationen	WB, ELISA
Specific against	Human
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	TGVAGVSSAMDHTFSTTSKDGEGSCYTSLISDICYPPQEDSTYFTGILQKENGHVTISESPEELGTPGPSLPDVPGIESRGLFSSDSGIEMTPAESTEVNKILADPLDQMKAEAYKYIDITRPEEVKHQEQHHPELEDKDLDFKNKDTDISIKPEGVREPDKPAPVEGKIIKDHLLEESTFAPYIDDLSEEQRRAPQITTPVKITLTEIEPSVETTTQEKTPEKQDICLKPSPDTVPTVTVSEPEDDSPGSITPP
NCBI	RTN1
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	RTN1;NSP
Lieferbar
Background	This gene belongs to the family of reticulon encoding genes. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. This gene is considered to be a specific marker for neurological diseases and cancer, and is a potential molecular target for therapy. Alternative splicing results in multiple transcript variants.
Route	Recombinant Protein
Manufacturers Category	Polyclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 80-340 of human RTN1 (NP_066959.1).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:2000
Protein Size	84kDa
Manufacturers Research Area	Neuroscience
Gene Symbol	RTN1

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1000 uL

lieferbar

Lieferung vsl. bis 27.09.2024

Express-Lieferung: 29 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail