Vergleich

ATP6V1A Rabbit pAb Europäischer Partner

ArtNr A14706-1000uL
Hersteller Abclonal
Menge 1000 uL
Kategorie
Typ Antibody Polyclonal
Applikationen WB, ELISA
Specific against Human
Isotype IgG
Konjugat/Tag Unconjugated
Purity Affinity purification
Sequence SLAETDKITLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGMLSNMIAFYDMARRAVETTAQSDNKITWSIIREHMGDILYKLSSMKFKDPLKDGEAKIKSD
NCBI ATP6V1A
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias ATP6V1A;ATP6A1;ATP6V1A1;HO68;VA68;VPP2;Vma1;ARCL2D
Lieferbar
Background
This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is one of two V1 domain A subunit isoforms and is found in all tissues. Transcript variants derived from alternative polyadenylation exist.
Route
Synthetic Peptide
Manufacturers Category
Polyclonal Antibodies
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 500-600 of human ATP6V1A (NP_001681.2).
Storage
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Recommended Dilution
WB, 1:500 - 1:2000
Protein Size
68kDa
Manufacturers Research Area
Signal Transduction, Endocrine Metabolism
Gene Symbol
ATP6V1A

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1000 uL
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen