« Zurück
Home /
NEK8 Rabbit pAb

NEK8 Rabbit pAb

ArtNr	A0984-1000uL
Hersteller	Abclonal
Menge	1000 uL
Kategorie	Antibodies Primary Antibodies
Typ	Antibody Polyclonal
Applikationen	WB, IF, ICC, ELISA
Specific against	Human
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	GSVRMRRAEKSVAPSNTGSRTTSVRCRGIPRGPVRPAIPPPLSSVYAWGGGLGTPLRLPMLNTEVVQVAAGRTQKAGVTRSGRLILWEAPPLGAGGGSLLPGAVEQPQPQFISRFLEGQSG
NCBI	NEK8
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	NEK8;JCK;NEK12A;NPHP9;RHPD2
Lieferbar
Background	This gene encodes a member of the serine/threionine protein kinase family related to NIMA (never in mitosis, gene A) of Aspergillus nidulans. The encoded protein may play a role in cell cycle progression from G2 to M phase. Mutations in the related mouse gene are associated with a disease phenotype that closely parallels the juvenile autosomal recessive form of polycystic kidney disease in humans.
Route	Recombinant protein
Manufacturers Category	Polyclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 270-390 of human NEK8 (NP_835464.1).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:100 - 1:500\|IF/ICC, 1:100 - 1:500
Protein Size	75kDa
Manufacturers Research Area	Epigenetics Nuclear Signaling, Kinase, Cell Cycle, Centrosome
Gene Symbol	NEK8

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1000 uL

lieferbar

Lieferung vsl. bis 27.09.2024

Express-Lieferung: 30 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail