LL - 37

ArtNr	EP11651_1
Hersteller	peptides & elephants
Menge	1 mg
Kategorie	Peptides & Proteins Peptides
Typ	Peptides
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	[LL-37, 37 aa] other name: Baculoviral IAP repeat-containing protein 7 (280-289); ML-IAP 280-289
Lieferbar
Description	The cathelicidin anti-microbial peptide LL-37 corresponds to aa 134-170 of the human cationic antimicrobial protein 18 (hCAP18). Antimicrobial peptide LL-37 belongs to the cathelicidin family of peptides, and this peptide corresponds to the sequence of the first amphipathic alpha-helical peptide isolated from human. It plays an important role in the first line of defense against local infection and systemic invasion of pathogens at sites of inflammation and wounds. Cytotoxic to both bacterial and normal eukaryotic cells , LL-37 is significantly resistant to proteolytic degradation in solution.
Keywords	[LL-37, 37 aa] other name: Baculoviral IAP repeat-containing protein 7 (280-289); ML-IAP 280-289
Sequence	[LL-37, 37 aa]
N-Terminus	H
C-Terminus	OH
Purity	0, 95
Counter-Ion	TFA
Storage	Store dry at -20°C

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1 mg

lieferbar

Lieferung vsl. bis 17.01.2025

Express-Lieferung: 24 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail