« Zurück
Home /
[Novoprotein] Recombinant E. coli Methionine Aminopeptidase/MetAP/MAP (C-6His)

[Novoprotein] Recombinant E. coli Methionine Aminopeptidase/MetAP/MAP (C-6His)

ArtNr	C151-10ug
Hersteller	Bon Opus
Menge	10ug
Kategorie	Peptides & Proteins Enzymes
Typ	Proteins Recombinant
Format	Liquid
Specific against	E.coli
Host	E.coli
Konjugat/Tag	His
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Sequence	AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGV STGELDRICNDYIVNEQHAVSACLGYHGYPKSVCI SINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFH GDTSKMFIVGKPTIMGERLCRITQESLYLALRMVK PGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRG FHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGK KEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCE ILT
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Methionine Aminopeptidase, MAP, Peptidase M, map
Similar products	peptidase-m
Lieferbar
Background	Methionine Aminopeptidase (MAP) is a member of the peptidase M24A family. MAP is essential for cell growth because it plays a central role for protein maturation as it removes the initiator Met residue from newly synthesized proteins.
Description	Recombinant E.coli Methionine Aminopeptidase is produced by our E.coli expression system & the target gene encoding Ala2-Glu264 is expressed with a 6His tag at the C-terminus.
Endotoxin	Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Formulation	Supplied as a 0.2 um filtered solution of 20mM TrisHCl, 100mM NaCl, 50% Glycerol, pH 8.0.
Molecular Weight	30, 4
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Seq Length	Ala2-Glu264
Ship Description	The product is shipped on dry ice/ice packs.
Storage	Store at < -20C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen