ArtNr |
CD44-1mg |
Hersteller |
Bon Opus
|
Menge |
1mg |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid |
Specific against |
Mouse |
Host |
Human |
Konjugat/Tag |
His |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
Sequence |
ELRSRRTGERQNLSPTDPRVQKAAQAAVASYNMGS DSLYYFRDTKVIDAKYQLVAGIKYYLTLDIESTEC RKTRVSGEHMDLTTCPLAAGGQQEKLRCNFELLEV PWKNTTQLLKHDCVQVVDHHHHHH |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Cystatin E/M, Cst6. |
Similar products |
CST6 |
Lieferbar |
|
Background |
Mouse CST6 is a member of the family 2 of the cystatin superfamily. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids & secretions, where they appear to provide protective functions. CST6 is expressed in heart, liver & kidney. In addition to its function as a cysteine protease inhibitor, CST6 also serves as a target for cross-linking by transglutaminases. Accordingly, CST6 was suggested to be involved in barrier formation & maintenance. Furthermore, studies have revealed that CST6 is frequently epigenetically inactivated during breast carcinogenesis, & thus be regarded as a candidate of tumour suppressor gene. |
Description |
Recombinant Mouse Cystatin E/M is produced by our Mammalian expression system & the target gene encoding Glu29-Val149 is expressed with a 6His tag at the C-terminus. |
Endotoxin |
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test. |
Formulation |
Supplied as a 0.2 um filtered solution of 20mM MES, 150mM NaCl, pH 7.4. |
Molecular Weight |
14, 8 |
Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Seq Length |
Glu29-Val149 |
Ship Description |
The product is shipped on dry ice/ice packs. |
Storage |
Store at < -20C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.