« Zurück
Home /
Recombinant Mouse Plasminogen Activator Inhibitor 1/PAI-1/SERPIN E1 (C-6His)

Recombinant Mouse Plasminogen Activator Inhibitor 1/PAI-1/SERPIN E1 (C-6His)

ArtNr	CD21-500ug
Hersteller	Bon Opus
Menge	500ug
Kategorie	Oncology Food Safety Proteins Peptides & Proteins Recombinant Proteins Cell Biology Cell Status Senescence By Organ Breast Cancer
Typ	Proteins Recombinant
Format	Lyophilized
Specific against	Mouse
Host	Human
Konjugat/Tag	His
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Sequence	LPLRESHTAHQATDFGVKVFQQVVQASKDRNVVFS PYGVSSVLAMLQMTTAGKTRRQIQDAMGFKVNEKG TAHALRQLSKELMGPWNKNEISTADAIFVQRDLEL VQGFMPHFFKLFQTMVKQVDFSEVERARFIINDWV ERHTKGMISDLLAKGAVDELTRLVLVNALYFSGQW KTPFLEASTHQRLFHKSDGSTVSVPMMAQSNKFNY TEFTTPDGLEYDVVELPYQGDTLSMFIAAPFEKDV HLS
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Plasminogen activator inhibitor 1, Endothelial plasminogen activator inhibitor, Serpin E1, Mr1, Pai1, Planh1,
Similar products	SERPIN E1
Lieferbar
Background	Plasminogen activator inhibitor-1 (serpin E1) is a serine protease inhibitor which belongs to the serpin family. Serpin E1 acts as 'bait' for tissue plasminogen activator, urokinase, protein C & matriptase-3/TMPRSS7. Its rapid interaction with PLAT may function as a major control point in the regulation of fibrinolysis.
Description	Recombinant Mouse Serpin E1/PAI-1 is produced by our Mammalian expression system & the target gene encoding Leu24-Ser402 is expressed with a 6His tag at the C-terminus.
Endotoxin	Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Formulation	Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH7.4.
Molecular Weight	43, 7
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Seq Length	Leu24-Ser402
Ship Description	The product is shipped at ambient temperature.
Storage	Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7C for 2-7 days. Aliquots of reconstituted samples are stable at < -20C for 3 months.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen