ArtNr |
CD18-1mg |
Hersteller |
Bon Opus
|
Menge |
1mg |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid |
Specific against |
Mouse |
Host |
Human |
Konjugat/Tag |
His |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
Sequence |
FYDTETLKVIDEEWQRTQCSPRETCVEVASELGKT TNTFFKPPCVNVFRCGGCCNEEGVMCMNTSTSYIS KQLFEISVPLTSVPELVPVKIANHTGCKCLPTGPR HPYSVDHHHHHH |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Vascular endothelial growth factor D, c-Fos-induced growth factor, FIGF, VEGFD, |
Similar products |
VEGFD |
Lieferbar |
|
Background |
Mouse vascular endothelial growth factor D, (VEGFD) is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family. VEGFD is a secreted protein & highly expressed in fetal & adult lung. It undergoes a complex proteolytic maturation, generating multiple processed forms that bind & activate VEGFR-2 & VEGFR-3 receptors. The structure & function of this protein is similar to VEGFC. VEGFD is growth factor which active in angiogenesis, lymphangiogenesis, & endothelial cell growth, stimulating their proliferation & migration & also has effects on the permeability of blood vessels. |
Description |
Recombinant Mouse Vascular Endothelial Growth Factor D is produced by our Mammalian expression system & the target gene encoding Phe98-Ser206 is expressed with a 6His tag at the C-terminus. |
Endotoxin |
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test. |
Formulation |
Supplied as a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH7.4. |
Molecular Weight |
13, 1 |
Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Seq Length |
Phe98-Ser206 |
Ship Description |
The product is shipped on dry ice/ice packs. |
Storage |
Store at < -20C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.