ArtNr |
C934-500ug |
Hersteller |
Bon Opus
|
Menge |
500ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Lyophilized |
Specific against |
Mouse |
Host |
Human |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
Sequence |
STGGKQRSQNRSKTPKNQEALRMASVAENSSSDQR QACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGE CAFPLNSYMNATNHAIVQTLVHFINPDTVPKPCCA PTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
SH2 Domain-Containing Protein 1A, Duncan Disease SH2-Protein, Signaling Lymphocytic Activation Molecule-Associated Protein, SLAM-Associated Protein, T-Cell Signal Transduction Molecule SAP, SH2D1A, DSHP, SAP |
Lieferbar |
|
Background |
Bone morphogenetic protein 7 (BMP-7) is a widely expressed TGF-ß superfamily member with important functions during embryogenesis, in the adult, & in disease. The growth factor domain of mouse BMP-7 shares 98% & 100% aa sequence identity with human & rat BMP-7, respectively. The BMP-7 propeptide is cleaved intracellularly but remains in association with the growth factor domain. BMP-7 is subsequently secreted as a tetramer that consists of two propeptides & two disulfide-linked growth factor domains. Mature BMP-7 can also form disulfide-linked heterodimers with BMP-2 or BMP-4, complexes that show increased potency & range of activity compared to BMP-7 homodimers. BMP-7 exerts its biological effects through the type 2 receptors Activin RIIA, Activin RIIB, & BMPR-II & the type 1 receptors Activin RIA, BMPR-IA, & BMPR-IB. BMP-7 plays a role in a variety of organ systems. It promotes new bone formation & nephron development, inhibits the branching of prostate epithelium, & antagonizes epithelial-mesenchymal transition (EMT). In pathological conditions, BMP-7 inhibits tumor growth & metastasis, ameliorates fibrotic damage in nephritis, & promotes neuroregeneration following brain ischemia. |
Description |
Recombinant Mouse/Rat Bone Morphogenetic Protein 7 is produced by our Mammalian expression system & the target gene encoding Ser292-His430 is expressed. |
Endotoxin |
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test. |
Formulation |
Lyophilized from a 0.2 um filtered solution of 4mM HCl. |
Molecular Weight |
15.6kD |
Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Ship Description |
Ambient |
Storage |
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7C for 2-7 days. Aliquots of reconstituted samples are stable at < -20C for 3 months. |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.