ArtNr |
C1129-1mg |
Hersteller |
Bon Opus
|
Menge |
1mg |
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
Mouse |
Host |
Human |
Purity |
Greater than 95% as determined by SEC-HPLC & reducing SDS-PAGE. |
Sequence |
LENAYVFEVGKNAYLPCSYTLSTPGALVPMCWGKG FCPWSQCTNELLRTDERNVTYQKSSRYQLKGDLNK GDVSLIIKNVTLDDHGTYCCRIQFPGLMNDKKLEL KLDIKAAKVTPAQTAHGDSTTASPRTLTTERNGSE TQTLVTLHNNNGTKISTWADEIKDSGETIRTAHHH HHH |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Hepatitis A virus cellular receptor 2 homolog, HAVcr-2, T-cell immunoglobulin & mucin domain-containing protein 3, T-cell immunoglobulin mucin receptor 3, T-cell membrane protein 3, Tim3, Timd3 |
Lieferbar |
|
Background |
T cell immunoglobulin & mucin domain-3 (TIM3), also called hepatitis A virus cellular receptor 2 (HAVCR2), is a transmembrane glycoprotein of the TIM family of immune regulating molecules & plays an important role in the Th1-mediated immune response. TIM3 is expressed on the Th1 cells, CD8 T-cells, monocytes, & dendritic cells, but not on Th2 cells. TIM3 expressed by monocytes & dendritic cells facilitates phagocytosis of apoptotic cells & up-regulates cross-presentation of apoptotic cell-associated antigens through interaction with phosphatidylserine. Engagement of TIM3 by its ligand galectin-9 induces a range of immunosuppressive functions which enhance immune tolerance & inhibit anti-tumor immunity. Stimulation of TIM3 with an agonistic antibody promotes inflammation through the activation of innate immune cells. TIM3 is also regarded as a potential target molecule for immunotherapy. TIM3 & programmed cell death 1 (PD-1) as two important coinhibitory regulators of T cell responses, have been implicated with the T-cell dysfunction or exhaustion associated with chronic HBV infection including HBV-related HCC. |
Description |
Recombinant Mouse Hepatitis A virus cellular receptor 2 homolog/Havcr2/Tim3 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Leu22-Ala193) of Mouse Havcr2/Tim3 fused with a 6His tag at the C-terminus. |
Endotoxin |
Less than 0.1 ng/ug (1 IEU/ug). |
Formulation |
PBS, pH7.4 |
Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in distilled water. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Shipping temperature |
Ambient |
State |
Lyophilized |
Storage |
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7C for 2-7 days. Aliquots of reconstituted samples are stable at < -20C for 3 months. |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.